Protein Info for Dsui_0124 in Dechlorosoma suillum PS

Annotation: lactate dehydrogenase-like oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF00389: 2-Hacid_dh" amino acids 27 to 317 (291 residues), 74.9 bits, see alignment E=5e-25 PF02826: 2-Hacid_dh_C" amino acids 105 to 287 (183 residues), 184.8 bits, see alignment E=1e-58

Best Hits

Swiss-Prot: 48% identical to Y1556_HAEIN: Putative 2-hydroxyacid dehydrogenase HI_1556 (HI_1556) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00018, glycerate dehydrogenase [EC: 1.1.1.29] (inferred from 74% identity to app:CAP2UW1_4209)

Predicted SEED Role

"D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 1.1.1.95)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.29 or 1.1.1.95

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM31 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Dsui_0124 lactate dehydrogenase-like oxidoreductase (Dechlorosoma suillum PS)
MHRIVYLERESIRAEVRRPAFAHEWTEYARTTAAQLEERLAGASIAIVNKLPISGALMAR
LPQLKMVAVAATGTNNVDLEAARRQGIVVSNIQGYAVHTVPEHVFSLLLALSRNLLAYRQ
SVAEGRWQRAEQFCFFDHPIRDLHGATLGVVGGGSLGQGVVRLAQAFGMKVLQAERKGAA
VVRPGYTAFATVLAEADALSLHCPLTAETRHLIGAAELQAMKPSALLINTARGGLVDEAA
LARALREGWIAGAGFDVLTAEPPTDDHPLLSPDLLAAPNFLLTPHVAWASAPAMQALADQ
LIDNLEAFARGAMTPGAANRVA