Protein Info for Dsui_0122 in Dechlorosoma suillum PS

Annotation: D-tyrosyl-tRNA(Tyr) deacylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 TIGR00256: D-tyrosyl-tRNA(Tyr) deacylase" amino acids 1 to 152 (152 residues), 166.9 bits, see alignment E=2e-53 PF02580: Tyr_Deacylase" amino acids 2 to 151 (150 residues), 183.9 bits, see alignment E=1.1e-58

Best Hits

Swiss-Prot: 67% identical to DTD_LARHH: D-aminoacyl-tRNA deacylase (dtd) from Laribacter hongkongensis (strain HLHK9)

KEGG orthology group: K07560, D-tyrosyl-tRNA(Tyr) deacylase [EC: 3.1.-.-] (inferred from 67% identity to lhk:LHK_02266)

Predicted SEED Role

"D-tyrosyl-tRNA(Tyr) deacylase (EC 3.6.1.n1)" (EC 3.6.1.n1)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.- or 3.6.1.n1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM29 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Dsui_0122 D-tyrosyl-tRNA(Tyr) deacylase (Dechlorosoma suillum PS)
MRVVLQRVSRAAVRVEGQVVGQIGPGLLLLVGIETADAVEPEATAAGMEWLVGKLLRLRI
FADAEGVMNRSLEEVGGEVLAVSQFTLFASTRKGNRPSWSRAAAPQAAEPLFARFVALLQ
ERLGRPVATGVFGADMAVSLDNDGPVTLVLDSRQPE