Protein Info for Dsui_0116 in Dechlorosoma suillum PS

Annotation: alkylhydroperoxidase AhpD family core domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 PF02627: CMD" amino acids 24 to 106 (83 residues), 77.7 bits, see alignment E=2.7e-26 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 41 to 88 (48 residues), 43.2 bits, see alignment E=1.1e-15

Best Hits

KEGG orthology group: None (inferred from 76% identity to app:CAP2UW1_0786)

Predicted SEED Role

"Possible carboxymuconolactone decarboxylase family protein (EC 4.1.1.44)" (EC 4.1.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.44

Use Curated BLAST to search for 4.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM23 at UniProt or InterPro

Protein Sequence (119 amino acids)

>Dsui_0116 alkylhydroperoxidase AhpD family core domain protein (Dechlorosoma suillum PS)
MSKSFTTITGDVSKALATLRKEIPDTMQGFNAMAKGALQGGAIDELHKELIALAIGVASR
CDACIGFHVKALIRLGVTKEQLMETLGICAYMGGGPTLMYAAEAVRAYEELTAKLQPAA