Protein Info for Dsui_0110 in Dechlorosoma suillum PS

Annotation: Histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 51 (19 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details PF06580: His_kinase" amino acids 127 to 205 (79 residues), 82.7 bits, see alignment E=9.2e-28

Best Hits

KEGG orthology group: K08082, two-component system, LytT family, sensor histidine kinase AlgZ [EC: 2.7.13.3] (inferred from 59% identity to dar:Daro_3680)

Predicted SEED Role

"Autolysin sensor kinase (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLK4 at UniProt or InterPro

Protein Sequence (318 amino acids)

>Dsui_0110 Histidine kinase (Dechlorosoma suillum PS)
MLRILLGANLLVAAAALLLAPRLEDWPQRLVELATWCEPLLLSTLGLLALGRDWLWRLKP
RAGQALVLLLVMAQALLFFDFWRFMGLIEGGWGAALRAALLAAAATLPLLLYFSLRARAF
SPAVAEARLQALTARIRPHFLFNSLNAVLSLIRQDPRRAETALEELADLFRALMRDARNL
SPLSDEIALCRQYLGLEKLRLGERLKVEWDIVDVPDDALVPPLMLQPLLENAVYHGIEPG
EGSGTIHIGFSRQGDAMVAELTNPCPPGQGHHAGNRMALANIRERLDLYYDLEARLESSE
QNGTYRVRITLPLRRPLP