Protein Info for Dsui_0109 in Dechlorosoma suillum PS

Annotation: response regulator of the LytR/AlgR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF00072: Response_reg" amino acids 11 to 123 (113 residues), 87.2 bits, see alignment E=8.6e-29 PF04397: LytTR" amino acids 159 to 259 (101 residues), 63.7 bits, see alignment E=1.6e-21

Best Hits

KEGG orthology group: K08083, two-component system, LytT family, response regulator AlgR (inferred from 53% identity to slt:Slit_0260)

Predicted SEED Role

"Autolysis response regulater LytR" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLK3 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Dsui_0109 response regulator of the LytR/AlgR family (Dechlorosoma suillum PS)
MTEPTPAPLSIVLVDDEAPARRRMGTLLEDLALELPTRVVGEAGDGEAALELIQQVQPDV
VLVDIRMPKMDGLELARHLAGLPRPPAVIFATAYDSHAVQAFDLNAVDYLLKPVRLARLQ
AALEKARLVGPLTAERLAKVRQESGQGARRHFSCHERGRILLVPVQEVLYLKADLKYVTA
RTREREYLLDEALTHLEQEFAERFIRLHRSVLVAKDALAGFERGQGDGEEGGEQWLALLK
EVPEKLPVSRRQWATVKQYAK