Protein Info for Dsui_0107 in Dechlorosoma suillum PS

Annotation: PDZ domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF13180: PDZ_2" amino acids 103 to 172 (70 residues), 36.3 bits, see alignment E=1.1e-12 PF00595: PDZ" amino acids 104 to 141 (38 residues), 24.7 bits, see alignment 5e-09 PF17820: PDZ_6" amino acids 106 to 146 (41 residues), 39.4 bits, see alignment 7.9e-14 PF01435: Peptidase_M48" amino acids 177 to 328 (152 residues), 70.9 bits, see alignment E=2.5e-23

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLK1 at UniProt or InterPro

Protein Sequence (358 amino acids)

>Dsui_0107 PDZ domain-containing protein (Dechlorosoma suillum PS)
MRHFITVLFVCLCVSACAPVTRRPAVDDQKTSAEKELQRDMAFKERLKRQERADAVAFRI
LTGAADLCEKQVKPSTGMRLIHNGMYKDEWSRSATKIIGKGPAPLVTNVAPQSPAQLAGV
QPGDRILSIENRTFSQSDSVQEALDAAMRSLEAGEATAIRIQRGEKEIEAQLTPVKACAY
PVTVVDNDAVNAYADGKQIILTSGMMRFAQDDNELGLVLGHELAHNTMGHLDKKRNNSLL
GALLGAVISVGTGVDVTRLAGDLGSMAFSQGFESEADYVGLYYAARAGFDVDNAPNFWRR
MAVEHPQAIGHGTSHPDTASRFLALEATSKEIAAKRTNGNPLHPERETLTETPLPSGN