Protein Info for Dsui_0101 in Dechlorosoma suillum PS

Annotation: exonuclease, DNA polymerase III, epsilon subunit family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 PF00929: RNase_T" amino acids 20 to 169 (150 residues), 108.5 bits, see alignment E=1.1e-34 TIGR00573: exonuclease, DNA polymerase III, epsilon subunit family" amino acids 20 to 174 (155 residues), 92.6 bits, see alignment E=1.2e-30 PF01541: GIY-YIG" amino acids 215 to 288 (74 residues), 30.1 bits, see alignment E=1e-10 PF27096: UvrC_M" amino acids 315 to 400 (86 residues), 69.9 bits, see alignment E=4.4e-23 PF27115: Cho_C" amino acids 412 to 483 (72 residues), 71.1 bits, see alignment E=1.1e-23

Best Hits

KEGG orthology group: K02342, DNA polymerase III subunit epsilon [EC: 2.7.7.7] (inferred from 57% identity to tbd:Tbd_0827)

Predicted SEED Role

"DNA polymerase III epsilon subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLJ5 at UniProt or InterPro

Protein Sequence (488 amino acids)

>Dsui_0101 exonuclease, DNA polymerase III, epsilon subunit family (Dechlorosoma suillum PS)
MADQPLASPPAPAPFREPLVFVDLETTGANPVRDRITEIGIVEVSAAGVTQWSSLVNPGI
PIPPFIQGLTNISDEMVADAPPFADLAEEVLGRLKGRLFVAHNARFDYGFLKNEFRRLGL
KFHATVLCTVKLSRKLEPQHHRHSLDALVERHGLYDEHRHRALSDARLIHQFWDRLHGKY
APEPIWAAVETLTQRPKLPPHLPPEALDDLPELPGVYLLYGQKADGEPLYIGKSSNLRQR
VFSHFSGDQKDARDTAMAAQVYRVEWRETAGELGAMLLEAKLLQAHRPSLNRHQKKGGEL
CAWQLVQEAPGDFRPRLVLADELDFGRSPDLYGLFNSAKEARNSLKKIGDAHHLCHVLLG
LEKQRPGKPCFGHQMHNCKGACCGKESLSQHSARLMAALAKLKVKEWPYAGPIGLVEKDD
FSSTTDLHVVDHWAYLGTAQREEQVWEILQQQGSRPAAFDQETYRLINKAIAQGAVEVRE
LTPPVQPA