Protein Info for Dsui_0096 in Dechlorosoma suillum PS

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details PF00672: HAMP" amino acids 100 to 153 (54 residues), 33.6 bits, see alignment 4e-12 PF00015: MCPsignal" amino acids 244 to 398 (155 residues), 126.2 bits, see alignment E=1.2e-40

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 65% identity to tmz:Tmz1t_1958)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLJ0 at UniProt or InterPro

Protein Sequence (605 amino acids)

>Dsui_0096 methyl-accepting chemotaxis protein (Dechlorosoma suillum PS)
MNNAPQQKSAFWQLYENIEKTFFNSLSKKLSSFLLLFCVDLGYLGVYFYQQNTIQQLLHS
GNASPELLARIGASLDSGLYIMGGLTLLALVMNIGQILYLRHLIVRPVKVITGIFNEIAR
GEGDFSRDLPLITQDELRELSAGYNRFAEKMRQIIGEVRKMSVSIAREAVLVKARVEDTV
KSAREQVRLTETVFTASSESTRAIQDVSGSTHAISDSTHGNLDIARQSLGEMQDIAGKIN
AVSDKVTRFNQTVDDLSHRSESVKQIAALIRDVADQTNLLALNAAIEAARAGEAGRGFAV
VADEVRKLAERVNKATAEIAGNINGVITLVENTRSENDEINADVLQTREVVSRSAEQFQR
MVGDFEGTSEKLLQIAAAMEELSATNEQVHENVDGIHRLSGSVAQHMEESEQRTLELAQA
TEAVQELVSRFKIGAGAFDQAVDRTRRFRDDLQAELEAMAKRGINIFDRSYQPIPDTNPQ
KYKVSWGDTYAQTCQGLLESCLKDIPGCAFAVGMTSDSYLSAHNLKYSKPLTGDYETDLV
GNRVCRKFERPSELRSAANTEPMLLQTYQRDTGEVLCDIAMPIYVGGRHWGNVRVGVPAD
ALLAT