Protein Info for Dsui_0089 in Dechlorosoma suillum PS

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details PF08269: dCache_2" amino acids 37 to 190 (154 residues), 144.6 bits, see alignment E=7.6e-46 PF17200: sCache_2" amino acids 40 to 188 (149 residues), 154.3 bits, see alignment E=4.9e-49 PF17201: Cache_3-Cache_2" amino acids 84 to 185 (102 residues), 31.3 bits, see alignment E=2.6e-11 PF00015: MCPsignal" amino acids 343 to 509 (167 residues), 150.6 bits, see alignment E=8.3e-48

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 51% identity to app:CAP2UW1_2166)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLI3 at UniProt or InterPro

Protein Sequence (544 amino acids)

>Dsui_0089 methyl-accepting chemotaxis protein (Dechlorosoma suillum PS)
MFNFERIKVRTRLMIFFAGVVLGLLAVGIFSLYVLRDNLMEDRRLKTRNVVESVLGVVDY
FHKQQQAGKLSEEEAKRQAMDSLRNVRYDGKEYFWVQDRNLVMLMHPIKPDMEGKSQAAL
KDPNGKLFFQEMENVVKASGKGFVDYLWPKPGFDQPAPKISYVAEFPAWGWVVGSGIYVD
DVNAVFRQQALLFSIMVVITLAILSVISWLINSSILRQLGGEPAYAVEVVRHIAEGDLVR
PVEYSSPDSLLAAMQTMQQKLANIFGDINGMASRLSSGAEHVSVAARETSVAAHNQAQST
SASAASIEQMTVSISEVSEIATQTEANSSQTAALAEEGAGLVKNAAQEIELISRTVATSS
EQIQLLQQRSQEIGGIANVIKEIADQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAE
RTAKATTEIAQMIDSIQEETQTAVQAMATAAPQVDKGLELATQATAMLDEIHRQALDSLG
KVRDVALATTEQATTATDIAKHVEHIASMAEETNATMQNNAAEAEQLEGLADQLRQTVSY
FRVS