Protein Info for Dsui_0086 in Dechlorosoma suillum PS

Annotation: nucleoside-diphosphate-sugar epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01370: Epimerase
  • amino acids 7 to 231 (225 residues), 226.5 bits, E=3.3e-71
• PF16363: GDP_Man_Dehyd
  • amino acids 41 to 309 (269 residues), 75.1 bits, E=7.3e-25

Best Hits

Swiss-Prot: 68% identical to FCL_ECOLI: GDP-L-fucose synthase (fcl) from Escherichia coli (strain K12)

KEGG orthology group: K02377, GDP-L-fucose synthase [EC: 1.1.1.271] (inferred from 79% identity to plt:Plut_1864)

MetaCyc: 68% identical to GDP-L-fucose synthase (Escherichia coli K-12 substr. MG1655)
GDP-L-fucose synthase. [EC: 1.1.1.271]

Predicted SEED Role

"GDP-L-fucose synthetase (EC 1.1.1.271)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 1.1.1.271)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (10/11 steps found)
• GDP-L-fucose biosynthesis I (from GDP-D-mannose) (3/3 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (8/14 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.271

Sequence Analysis Tools

See G8QLI1 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Dsui_0086 nucleoside-diphosphate-sugar epimerase (Dechlorosoma suillum PS)
MSPMPKIYVAGHRGMVGSAIVRTLLGQGVRSQDIITRTHAELDLTNQTEVRAFFAAERPE
QVYLAAARVGGIHANNTYPAEFIYDNLMIEANVVDAAFRAGVRKLLFLGSSCIYPKLAPQ
PIAEGALLTGTLEPTNEPYAVAKIAGIKLCESYNRQYGVDYRSVMPTNLYGPGDNYHPEN
SHVIPALIRRFHEAKSANVPVVTVWGSGTPMREFLYVDDMAAASVHVMNLDKARYDQHTQ
PMLSHINVGCGYDITIRELAETVARVTGYSGKIEFDASKPDGTPRKLMDSSRLNALGWQA
KVSLEEGLSAAYRDFVEIQLPRS