Protein Info for Dsui_0081 in Dechlorosoma suillum PS

Annotation: pseudaminic acid CMP-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 TIGR03584: pseudaminic acid cytidylyltransferase" amino acids 3 to 224 (222 residues), 354.7 bits, see alignment E=9.7e-111 PF02348: CTP_transf_3" amino acids 4 to 161 (158 residues), 106.2 bits, see alignment E=2.3e-34 PF12804: NTP_transf_3" amino acids 8 to 156 (149 residues), 30.8 bits, see alignment E=3.1e-11

Best Hits

Swiss-Prot: 44% identical to PSEF_CAMJJ: Pseudaminic acid cytidylyltransferase (pseF) from Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)

KEGG orthology group: K00983, N-acylneuraminate cytidylyltransferase [EC: 2.7.7.43] (inferred from 73% identity to psa:PST_3838)

Predicted SEED Role

"N-Acetylneuraminate cytidylyltransferase (EC 2.7.7.43)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.7.7.43)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLH6 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Dsui_0081 pseudaminic acid CMP-transferase (Dechlorosoma suillum PS)
MRLAVIPARGGSKRIPRKNIKTFCGKPMIAWSIEAALASTCFDRIIVSTDDEEIAAVARG
WGAEVPFFRPAELSGDHAGTIPVIAHAVQWQQANGKAADQVCCIYATAPFVHAQDLQTGF
QTLLNTGADYAFSVTSFAFPIQRAIRITKEHRVEMFHPEHFHTRSQDLEEAFHDAGQFYW
GRADAWLAGKPIFSQDAAPVILPRHRVQDIDTPEDWERAEWMFRAQQQATAA