Protein Info for Dsui_0040 in Dechlorosoma suillum PS

Annotation: FAD-dependent dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 PF28550: DUF8436" amino acids 1 to 59 (59 residues), 51.6 bits, see alignment 2.8e-17 PF01593: Amino_oxidase" amino acids 212 to 271 (60 residues), 20.4 bits, see alignment 8.7e-08 PF21688: FAD-depend_C" amino acids 289 to 485 (197 residues), 289.9 bits, see alignment E=4.1e-90

Best Hits

Swiss-Prot: 53% identical to Y202_CLOB8: Uncharacterized protein Cbei_0202 (Cbei_0202) from Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)

KEGG orthology group: K07137, (no description) (inferred from 78% identity to dar:Daro_3016)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenase, sll0175 homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLD6 at UniProt or InterPro

Protein Sequence (542 amino acids)

>Dsui_0040 FAD-dependent dehydrogenase (Dechlorosoma suillum PS)
MLRLTEIKLPLDHPEADLRSAVCQRLGIADGDLLGYSVYRRSFDARKKSAIVFIYAIDAE
VRDEAAVLKRLAGDKHVMPSPDTTYRFVARAPAQLATRPVVIGTGPCGLFAGLLLAQMGF
KPIILERGKAVRERTKDTWGLWRKGELNPDSNVQFGEGGAGTFSDGKLYSQIKDPQHHGR
KVLEEFVKAGAPEEILYISKPHIGTFRLVGMVEKMRANIIELGGEVRFGCRVEEIEIERD
AAGNGQVRGVVLADGERIPSDHVVLAVGHSARDTFHMLYAKGVYIEAKPFSIGVRIEHPQ
ALIDKARFGPFAGHPLLGAADYKLVHHCSNGRSAYSFCMCPGGTVVAATSEPGRVVTNGM
SQYSRNERNANSGIVVGIAPETDYPGHPLAGIDFQRHWESKAFEAGGGTYAAPAQRVGDF
LAGRPSTAPGGVEPSYTPGVHWTDLSQCLPSYVVQALREALPAFDRQIRGFAMADAVMTG
VETRTSSPIRIKRGDDLQSLNTRGLYPAGEGAGYAGGILSAGVDGIKVAEAVALDMVGRP
AA