Protein Info for Dsui_0035 in Dechlorosoma suillum PS

Annotation: ankyrin repeat-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF12796: Ank_2" amino acids 84 to 174 (91 residues), 70.2 bits, see alignment E=4.6e-23 amino acids 168 to 232 (65 residues), 30.8 bits, see alignment E=9.3e-11 PF13637: Ank_4" amino acids 90 to 133 (44 residues), 35.7 bits, see alignment 1.9e-12 amino acids 123 to 165 (43 residues), 37.7 bits, see alignment 4.9e-13 amino acids 149 to 189 (41 residues), 24.9 bits, see alignment 5.1e-09 PF00023: Ank" amino acids 113 to 141 (29 residues), 21.5 bits, see alignment (E = 5.6e-08) amino acids 146 to 174 (29 residues), 33.8 bits, see alignment (E = 6.6e-12) PF13857: Ank_5" amino acids 132 to 182 (51 residues), 33.9 bits, see alignment 7.9e-12 PF13606: Ank_3" amino acids 146 to 173 (28 residues), 24 bits, see alignment (E = 8.4e-09)

Best Hits

Predicted SEED Role

"FOG: Ankyrin repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKS2 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Dsui_0035 ankyrin repeat-containing protein (Dechlorosoma suillum PS)
MKFSPTLPTCSPLATPARRLLAALALGLCLGTGPALAQQAAGFQPPSPISFGVALEMGNL
DQAREWLDAGLPPDYQADRVGTGLMIGAWEGNVALMELFHARGADLNAVNDKGEQALLLA
AWKGHLKAVQWLLEHGAQVNREGYAWSALHYAVFAGHAEVAEYLLKRGADVNAQAPNGSS
VLMMAAYEGKDALAVRLMEWGADPKLRNENGQTALDWAMKYDHLKVARVITNPEEFIDAA
NRPKADWGVARKSEKVPAEIQRLLEVRRAMEAKGYDLSRIDQRISAARARYARLPPGARD
LPPAIGLEISASRANPQVQKARLVGKPAAPAAAKKPVAARGKATPAKKR