Protein Info for Dsui_0034 in Dechlorosoma suillum PS

Annotation: flagellar capping protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 PF02465: FliD_N" amino acids 52 to 116 (65 residues), 36.5 bits, see alignment E=6.2e-13 PF07195: FliD_C" amino acids 227 to 436 (210 residues), 78.7 bits, see alignment E=4.7e-26

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKS1 at UniProt or InterPro

Protein Sequence (478 amino acids)

>Dsui_0034 flagellar capping protein (Dechlorosoma suillum PS)
MDSSGLTSIYAYYNPYGLYGLGGLSSLGAVAAANRSQGSSSVSGIGGSSWTTVSSLGQTL
SAVSNLQTAAEKLTKPGAFSSLSVASSAPTVARGSAAEGTAQGAYTVRVDQLAQQQVLTS
AAQATQYTAIGSGADTTVNFQFANGRSASVDIDGGDNTVKGLAAAINRADIGVSASVVSG
PTGYQLQLSGESGAGNAFTVSASGDSTLSDFFSSPPGGNGLLLTQQAQDAKGSVNGSAFT
SGTNTATTSVEGLTLKLNATGTTNLTVGGNADQAAAVTDFVKAYNAVQSGLNSLSREYAG
FNLTAPYLRNTLSQALTPGAAAGSGNIQKLADIGISSNANGSLSVDTEKLRSALSSNADA
VASLFSTDKGEGVADRILAQVSEDGALAVDNLLKSAAPSLTTAGLSTANLQSNLLNAMFN
QQQNWLSQYSGLGSLTASLGSTDSLLSSLLGSSSNNLSGLGLIGGLSNPATVTSLFSS