Protein Info for Dsui_0031 in Dechlorosoma suillum PS

Annotation: cation/cationic drug transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 signal peptide" amino acids 5 to 5 (1 residues), see Phobius details transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 52 (22 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 4 to 94 (91 residues), 79.7 bits, see alignment E=9.6e-27

Best Hits

KEGG orthology group: K11741, quaternary ammonium compound-resistance protein SugE (inferred from 53% identity to abo:ABO_2544)

Predicted SEED Role

"Quaternary ammonium compound-resistance protein SugE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKR8 at UniProt or InterPro

Protein Sequence (107 amino acids)

>Dsui_0031 cation/cationic drug transporter (Dechlorosoma suillum PS)
MVGYWLILAVAVVTEILWALSLKYIQQHPGPWPVAASLGLTLVNMALLSLAMRGIPAGVA
YAVWTGLGAVGVAICGALFFGDQLNGGQMGAMAVVIAGVVGMKLATG