Protein Info for Dsui_0009 in Dechlorosoma suillum PS

Annotation: ATP-dependent Clp protease ATP-binding subunit clpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 751 TIGR02639: ATP-dependent Clp protease ATP-binding subunit ClpA" amino acids 3 to 732 (730 residues), 1106.4 bits, see alignment E=0 PF02861: Clp_N" amino acids 4 to 126 (123 residues), 99 bits, see alignment E=1.5e-31 PF13191: AAA_16" amino acids 185 to 275 (91 residues), 32.6 bits, see alignment E=7.5e-11 PF00004: AAA" amino acids 209 to 341 (133 residues), 50.6 bits, see alignment E=1.8e-16 amino acids 490 to 607 (118 residues), 44.4 bits, see alignment E=1.4e-14 PF17871: AAA_lid_9" amino acids 348 to 451 (104 residues), 91.9 bits, see alignment E=1.4e-29 PF07724: AAA_2" amino acids 484 to 644 (161 residues), 202.1 bits, see alignment E=4.2e-63 PF00158: Sigma54_activat" amino acids 489 to 607 (119 residues), 21.3 bits, see alignment E=1.2e-07 PF07728: AAA_5" amino acids 489 to 607 (119 residues), 50.2 bits, see alignment E=1.8e-16 PF10431: ClpB_D2-small" amino acids 651 to 731 (81 residues), 83.4 bits, see alignment E=6.2e-27

Best Hits

Swiss-Prot: 63% identical to CLPA_ECOLI: ATP-dependent Clp protease ATP-binding subunit ClpA (clpA) from Escherichia coli (strain K12)

KEGG orthology group: K03694, ATP-dependent Clp protease ATP-binding subunit ClpA (inferred from 85% identity to app:CAP2UW1_4058)

MetaCyc: 63% identical to ATP-dependent Clp protease ATP-binding subunit ClpA (Escherichia coli K-12 substr. MG1655)
Endopeptidase Clp. [EC: 3.4.21.92]

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.92

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKP6 at UniProt or InterPro

Protein Sequence (751 amino acids)

>Dsui_0009 ATP-dependent Clp protease ATP-binding subunit clpA (Dechlorosoma suillum PS)
MIAQELEVSLHMAFVEARQKRHEFITVEHLLLALVDNPSAAEALRACSANVEQLRRDLQT
FIDEHTPTVSGEDEIDTQPTLGFQRVIQRAILHVQSSGKKEVTGANVLVAIFGEKDSHAV
FFLQKQGVTRLDVVNFISHGISKSPQPAKAETEQETDGDGRPEAGPLESYTINLNAQALQ
GKIDPLIGRDKELERVIQTLCRRRKNNPLLVGEAGVGKTAIAEGLARRVVEGEVPEILAK
AHVYALDMGALLAGTKYRGDFEQRLKGVLKALQDNPDAILFIDEIHTLIGAGAASGGTLD
ASNLLKPALSGGQLKCIGATTYTEYRGIFEKDHALSRRFQKIDVNEPSVAETVEILKGLK
TRFESHHGIKYSSAAINSAVELAARFITDRHLPDKAIDVIDEAGAAQRILPKSRQKKIIG
KPEIEEIVAKIARIPSSHVSNDDKATLKNLERDLKATVFGQDAAIDALAKAIKMARSGLG
APGKPIGAFLFSGPTGVGKTEVAKQLAYFLGVDLTRFDMSEYMERHAVSRLIGAPPGYVG
FDQGGLLTEAVTKKPYCVLLLDEIEKAHPDIYNILLQVMDHGTLTDNNGRKADFRNVVII
MTTNAGAAELQKPSVGFTSSKEVGDEMVEIKRLFTPEFRNRLDATISFKPLDHDIILRVV
DKFLMQLEEQLHEKKVEAVFTDALKDMLAERGFDPLMGARPMARLIQDTIRAALADELLF
GRLAHGGKVTVDVDKEGKVKLEFAKEAEAVA