Protein Info for CSW01_19625 in Vibrio cholerae E7946 ATCC 55056

Annotation: tRNA cytosine(34) acetyltransferase TmcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08351: TmcA_N
  • amino acids 90 to 141 (52 residues), 24.4 bits, 7.4e-09
• PF05127: Helicase_RecD
  • amino acids 209 to 375 (167 residues), 197.8 bits, E=4.1e-62
• PF13718: GNAT_acetyltr_2
  • amino acids 410 to 521 (112 residues), 51.1 bits, E=3.6e-17
  • amino acids 524 to 571 (48 residues), 24.7 bits, 4.5e-09
• PF00583: Acetyltransf_1
  • amino acids 422 to 524 (103 residues), 33.2 bits, E=1.8e-11
• PF13508: Acetyltransf_7
  • amino acids 460 to 525 (66 residues), 29.9 bits, E=1.8e-10

Best Hits

Swiss-Prot: 100% identical to TMCA_VIBCH: tRNA(Met) cytidine acetyltransferase TmcA (tmcA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K06957, tRNA(Met) cytidine acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to vch:VCA1112)

Predicted SEED Role

"Predicted P-loop ATPase fused to an acetyltransferase COG1444"

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Protein Sequence (708 amino acids)

>CSW01_19625 tRNA cytosine(34) acetyltransferase TmcA (Vibrio cholerae E7946 ATCC 55056)
MFPPSYDAFQGVTAIGWACANMAHHFGISLVMTQPITYLLQLQQLAKQGQTRFGCWLRGD
AQWQHHLLKTLVPHFAEQPILMLGQTELEGVTCVDYRQGQQWLGRECQLLIVDLTQGWDA
NSFNAVLGTLVGGGLLLVVGEPTTLNHCARVWLERACHRLLVITPQTVPALPNSDSVTRT
NTEQTYTEQRLAIDSIIKVVTGHRKRPLVLTADRGRGKTSALGLAAAELMSSRSMHIVVT
APTLAAVEPLFVHAQRTLPQAHRQRGEVQTAQSSLRFMAPDELLRTQPESDLLLVDEAAA
LPLPFLKRWVERYHRAVFSSTIHGYEGCGRGFSLKFQSWLQVQRPQMRSLHLEQPIRWAA
GDALEQWQNQVFLLQSELPEVALEQAREPLSFSLFSQPECVEQPERLAQVFALLVNAHYQ
TSPNDLFALLQDEAMTLFVAYQGEVCVGCVLAVREGELDAPTIEAIQLGTRRPKGHLTPV
TLANQLGISQAARQSCWRILRIAVHPDCQRQGIGSQLLTHFIAQHHADYYATSFGVSEDL
LPFWLANHFVPIKLGSHRDQASGCYSLLMVRGEHLDWLEQAKQQFSAHWIFELSDSLQAL
EPQIIQQLLPSTVALPQPLIPLELIERYARGGANYESVAVWLYAWLLATAPSLESLSPLL
ISKILQRKSWAACAEQFQLSGKRQVEQAVRTEILALLVNLQCKYTLPI