Protein Info for CSW01_19505 in Vibrio cholerae E7946 ATCC 55056

Annotation: two-component system sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 PF00072: Response_reg" amino acids 3 to 116 (114 residues), 75.3 bits, see alignment E=6.5e-25 PF07228: SpoIIE" amino acids 192 to 380 (189 residues), 137.8 bits, see alignment E=6.8e-44 PF13581: HATPase_c_2" amino acids 421 to 552 (132 residues), 30.4 bits, see alignment E=5.1e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_A1043)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit / Serine-protein kinase RsbW (EC 2.7.11.1)" in subsystem SigmaB stress responce regulation (EC 2.7.11.1)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (568 amino acids)

>CSW01_19505 two-component system sensor histidine kinase/response regulator (Vibrio cholerae E7946 ATCC 55056)
MRVMIVDDHGTNRELCRFILAHIASHIDTFEDGQQAIDAMREMEILPDVILLDVMMPIKD
GFVTAKEIRQAFVKHHIPIIFLTVLDDRDSFEKCLALGDDFILKPVERSVLIAKVQAHYR
IVKMHNEVMEQRDELRHFREQVQYDYAISESIFTNLMEEMCHQVEHIFGIHYISTPSTIF
NGDLIVVANRPHGGVYVMIADATGHGLPAAISTIPATRTFFSTAQKGLSLGEMVIELNHS
LERFLPVGMMLAASVFEVRANGFEISWWGGGLPEAYLLDHHGNIVSRLISNHMPLGVLPS
NEFEADVQHFKLEPNQKLVCYTDGIIEAMNEQGEYFGQERLEHVLTKAYSEALIPTLYDA
VKKFSNRGKGDDLSILTMTFPITNSNSSDKALPKVVLSCIPLQTELHFPADVLRKISLMN
EVRRFLTGIVSGGEDLDLLCSVLSELFANAIEHGLLELDSSLKETPDGFFEFYQLRDKRL
KTLPEYHWLILKVNYQPDKQRIEIDLEHSGKGFDCQALKDASNQKSYGRGILLATQLCES
LEYSNQGRRVTAVYSFARKDTLHYSLPS