Protein Info for CSW01_19495 in Vibrio cholerae E7946 ATCC 55056

Annotation: type I secretion system permease/ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 704 transmembrane" amino acids 157 to 179 (23 residues), see Phobius details amino acids 191 to 208 (18 residues), see Phobius details amino acids 263 to 287 (25 residues), see Phobius details amino acids 293 to 310 (18 residues), see Phobius details amino acids 379 to 399 (21 residues), see Phobius details amino acids 406 to 429 (24 residues), see Phobius details TIGR03375: type I secretion system ATPase" amino acids 3 to 698 (696 residues), 969.3 bits, see alignment E=5.6e-296 PF00664: ABC_membrane" amino acids 158 to 420 (263 residues), 88.3 bits, see alignment E=7.4e-29 PF00005: ABC_tran" amino acids 487 to 635 (149 residues), 113.2 bits, see alignment E=1.5e-36

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to vcm:VCM66_A1041)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (704 amino acids)

>CSW01_19495 type I secretion system permease/ATPase (Vibrio cholerae E7946 ATCC 55056)
MQDTLLNSLVYVSRYYGLANSPEALINGLPLADGKLTPFLFPRSAERAGLIAKENRAPLD
QIPHLVFPVVLLLKGGEACVLNSINQETQEAEIVTAESGLVPVAYSLSDLEAMYIGRYFM
VKKQFRFDERSPEVLKPRDGHWFWSTIYKSKHIYRDVLIASLLINLFAVAAPMFSRIVYD
KVVPNLAFETLWVLSSGILVIFLFDFVFKMLRSYFIDVAGKKSDILISSKLFSKVMGIRM
EARPPSVGAFARHLQEFESIREFFTSATISSLIDLPFALLFLVLIWLMAGHLVWVPVIGV
LILVIYSFLIQSRLKRAIEEGSRLASQKYANLIESLAGLETVKLFGAQGQFQYRWEEAVA
HMANWNIKSRRITDSIQNTAGFVQQAANIGMIIVGVYLISNGDLTMGGLIAATMLSGRAI
GPLVQLSLLSTRYNQAKSSMTIIEQVMSMPDEQEEGKRYIHRPIIQGKIELDRVTFHYPN
SPIASVRDLSLTIHPGEKVAIIGRIGSGKTTLERLIMGLYKPTEGHVRIDDTDISQLHHI
DIRRNIGCVPQDSVLFYGSIRDNITLGRPLSDDREVMDAANRAGVTVFTQQDPAGLERQV
GEGGMLLSGGQRQSVSIARAFLGRPPVLLMDEPTSAMDNRSEMHIKQQLSQLKPSETLIL
ITHKTSMLDVVDRVIVMEKGCIIADGPKHEVLNDLRQGNVRAVQ