Protein Info for CSW01_19490 in Vibrio cholerae E7946 ATCC 55056

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 636 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details PF16448: LapD_MoxY_N" amino acids 23 to 146 (124 residues), 131.5 bits, see alignment E=2.4e-42 PF00990: GGDEF" amino acids 237 to 385 (149 residues), 50.1 bits, see alignment E=4.3e-17 PF00563: EAL" amino acids 411 to 634 (224 residues), 139.6 bits, see alignment E=1.7e-44

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_0160)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (636 amino acids)

>CSW01_19490 GGDEF domain-containing protein (Vibrio cholerae E7946 ATCC 55056)
MTLYKQLVAGMIAVFILLLISVFTIEFNTTRNSLEQQQRSEVNNTINTVGLALAPYLEKK
DTIAVESVINALFDGSSYSIVRLIFLDDGTEILRSYPIQPNNVPAWFTQLNLFEPIHDRR
VVTSGWMQLAEVEIVSHPGAAYAQLWKALIRLSIAFLAILVIGMFAVAFILKRSLRPLQL
IVNKMEQVANNQFGEPLPRPNTRDLIYVVDGINKMSEQVEKAFKAQAKEAQQLRERAYLD
PVSHLGNRAYYMSQLSGWLSESGIGGVAILQAEFIKELYEEKGYEAGDGMVRELADRLKN
SITIKDISIARISTYEFGIIMPNMDETELKIVAESIITCVDDINPDPTGMAKANLSLGVV
SNKRQSSTTTLLSLLDNALAKAKSNPELNYGFISSDTDKIILGKQQWKTLVEEAIHNDWF
TFRYQAANSSWGKTFHREVFSAFEKDGVRYTANQFLFALEQLNASHIFDQYVIERVIQQL
EKGELTDPLAINIAQGSISQPSFIRWISQTLSKHLSVANLLHFEIPEGCFVNEPHYTALF
CNAVRNAGADFGVDNYGRNFQSLDYINEFRPKYVKLDYLFTHHLDDERQKFTLTSISRTA
HNLGITTIASRVETQTQLDFLSEHFIEVFQGFIVDK