Protein Info for CSW01_19375 in Vibrio cholerae E7946 ATCC 55056

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00106: adh_short" amino acids 4 to 189 (186 residues), 172.5 bits, see alignment E=1.9e-54 PF01370: Epimerase" amino acids 5 to 224 (220 residues), 27.8 bits, see alignment E=4.3e-10 PF08659: KR" amino acids 5 to 162 (158 residues), 42.5 bits, see alignment E=1.7e-14 PF13460: NAD_binding_10" amino acids 9 to 220 (212 residues), 36.8 bits, see alignment E=9.3e-13 PF13561: adh_short_C2" amino acids 9 to 218 (210 residues), 127.4 bits, see alignment E=1.8e-40

Best Hits

Swiss-Prot: 43% identical to Y1627_STAS1: Uncharacterized oxidoreductase SSP1627 (SSP1627) from Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_A1015)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>CSW01_19375 NAD(P)-dependent oxidoreductase (Vibrio cholerae E7946 ATCC 55056)
MKSLVVITGASSGIGEAIARRFSEAGHPLLLVARRVERLEALNLPNTLCEKVDVTEAATL
VAAIAKAEALYGPADLLVNNAGVMLLGQIDTQEANEWKRMFDVNVLGLLNGMHAVLADMK
DRNYGTIVNISSIAGKKTFPNHAAYCGTKFAVHAISENVREEVAASNVRVTTIAPGAVET
ELLSHTTSNEIKEGYDAWKVDMGGVLAADDVARAVLFAYQQPQSVCIREIALAPTKQQP