Protein Info for CSW01_19280 in Vibrio cholerae E7946 ATCC 55056

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 64 to 89 (26 residues), see Phobius details amino acids 103 to 149 (47 residues), see Phobius details amino acids 172 to 184 (13 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 60 to 154 (95 residues), 77 bits, see alignment E=6.7e-26 PF00528: BPD_transp_1" amino acids 81 to 259 (179 residues), 79.8 bits, see alignment E=1.1e-26

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to vco:VC0395_0203)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>CSW01_19280 amino acid ABC transporter permease (Vibrio cholerae E7946 ATCC 55056)
MMIKRFFRPLLFAALQMMLVFAGLVWLLDSGAEAMGYTWQWHRVPEYVLIFEDGEWWAGD
LLHGLLVTLQLTGISLIFTLALGLTTALLRQSRSLVGRALGTGYIAVVRNTPLLVQIYLL
YFVFGPVIGLDRFATAVLALALFQGAYTAEVFRGGLNSIPQGQYEAARSLGLSRFFTFYD
VILPQLLQRTLPPLTNEMVSLIKNSSIVSVMAIFDLTTQGRNIVSETAMPFEIWFSVAAI
YLLLTLTLSALSAWLEHKLGAQWRSP