Protein Info for CSW01_19220 in Vibrio cholerae E7946 ATCC 55056

Annotation: sel1 repeat family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details PF08238: Sel1" amino acids 82 to 97 (16 residues), 11.5 bits, see alignment (E = 2e-05) amino acids 143 to 169 (27 residues), 11.7 bits, see alignment (E = 1.8e-05) amino acids 207 to 242 (36 residues), 24.8 bits, see alignment 1.2e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_0215)

Predicted SEED Role

"FOG: TPR repeat protein, SEL1 subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>CSW01_19220 sel1 repeat family protein (Vibrio cholerae E7946 ATCC 55056)
MNIIGIAIGATGLTLILIFVWMIVLSVRRKRLEEERRAREEAYRKALERNREQERKERLF
KAESGHIPTILFLAKEAERNSLKEALFWYEKAAHLDNIPAMYGIVRVCQRIREDVIAKEK
AKFWQTCVRGVEGDLAAKFETGMAWLYGRGVEVNVSRGIGLIQEAAEANFIDAILFMGGW
CVSKDNIAPTPSDSTFWYEKAARMGSAEGMMRLGQNLLHGIGGASDFPMACYWLERASEK
GHPEAMYHAGEAWIDRGAHGKAIAYIWLFLSASMGYEPAKNLRDLVGGKLGVESIVGLQA
LAKPLQRKLATSSVTKHSMIRALNKLYKRQIPIPTKDVVDPLAEQEAESLIDLIEPNALN
DLPHVASERLDFSQGPIDSLPFDKR