Protein Info for CSW01_19190 in Vibrio cholerae E7946 ATCC 55056

Annotation: DoxX family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 62 to 83 (22 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details PF07681: DoxX" amino acids 18 to 104 (87 residues), 92.2 bits, see alignment E=2.6e-30 PF04173: DoxD" amino acids 72 to 147 (76 residues), 25.4 bits, see alignment E=1.2e-09

Best Hits

Swiss-Prot: 42% identical to MHQP_BACSU: Putative oxidoreductase MhqP (mhqP) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to vch:VCA1019)

Predicted SEED Role

"Membrane protein, distant similarity to thiosulphate:quinone oxidoreductase DoxD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>CSW01_19190 DoxX family protein (Vibrio cholerae E7946 ATCC 55056)
MMNTLLKTALTSPNSWAPLALRLPLAIIFMAHGAQKLFGWFGGYGLEGTGQWMASIGLEP
GVAMAFLAGSGEFFGGLAILLGLLTRPAALVLSVTMLVAIFSVHFSHGLFLSNGGYEFGL
ALLAGSVSLLISGAGRLSLDNLLLKRLA