Protein Info for CSW01_19160 in Vibrio cholerae E7946 ATCC 55056

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details PF07670: Gate" amino acids 30 to 125 (96 residues), 40.2 bits, see alignment E=2.1e-14

Best Hits

Swiss-Prot: 53% identical to YJIG_ECOL6: Inner membrane protein YjiG (yjiG) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_A0971)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>CSW01_19160 hypothetical protein (Vibrio cholerae E7946 ATCC 55056)
MSNVNMKKPMVTDIFVEGAKKGWVIATTSTVPNVLMAFVIIKALQITGALDLMGTVFSPV
MAVFGLPGEAAAVLIGAWMSMGGAVGVVITLFDQGILNGTHIAILAPAIYLMGSQVQYIG
RILGPIGTEGRYIPVMIGISVLNAFGAMWVMNLFL