Protein Info for CSW01_19150 in Vibrio cholerae E7946 ATCC 55056

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 184 to 201 (18 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 247 to 264 (18 residues), see Phobius details amino acids 270 to 286 (17 residues), see Phobius details PF00892: EamA" amino acids 10 to 144 (135 residues), 41.7 bits, see alignment E=6.9e-15 amino acids 156 to 284 (129 residues), 45.8 bits, see alignment E=3.8e-16

Best Hits

Swiss-Prot: 100% identical to RIBN_VIBCH: Riboflavin transporter (ribN) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_0229)

Predicted SEED Role

"Putative transporter, DME family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>CSW01_19150 EamA family transporter (Vibrio cholerae E7946 ATCC 55056)
MSIKHHPLQGALWMLTAGLAFAIVNSVAQYASIQFGLPSTTVALVQYAIAIVVILPYLKT
LGIRQSLRTQQFGWHLLRVFLAVIGIQLWLWALAYPVPIWQGIALLMTSPLFATIGSGLW
LREKVGMARWVATLTGFIGAMIILEPWADDFNLASLLPVGAAFFWASYSLMVKKLSSHDS
PSTMVVYLLLLITPFNLLLALPDWQMPNGQTVWLLLIGAGVMTALAQWAIAKAYAVADAS
FVQPFDHAKLPLNVLAGWLVFGWVPPGRLWLGAAIIVLSVAFITQWETKKSRRERNIA