Protein Info for CSW01_18845 in Vibrio cholerae E7946 ATCC 55056

Annotation: maltose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 258 to 281 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 111 to 286 (176 residues), 68.4 bits, see alignment E=3.5e-23

Best Hits

Swiss-Prot: 100% identical to MALG_VIBCH: Maltose/maltodextrin transport system permease protein MalG (malG) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K10110, maltose/maltodextrin transport system permease protein (inferred from 100% identity to vcj:VCD_000391)

MetaCyc: 82% identical to maltose ABC transporter membrane subunit MalG (Escherichia coli K-12 substr. MG1655)
ABC-16-RXN [EC: 7.5.2.1]; 7.5.2.1 [EC: 7.5.2.1]; 7.5.2.1 [EC: 7.5.2.1]

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>CSW01_18845 maltose ABC transporter permease (Vibrio cholerae E7946 ATCC 55056)
MAMVQGKSLKYRVWATHAALWVFLALIIFPLLMIVAISFREGNFATGSLIPDRPSLEHWK
LALGIAVQNADGSVTPPPFPVMTWLWNSVKVAGITSVLIVALSTTSAYAFARMRFKGKET
ILKAMMIFQMFPAVLALVALYALFDKLGQYIPFLGLNTHGGLIFSYLGGIALHVWTIKGY
FETIDRSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIGVVGEVPVASLLLSDV
NSYTLAVGMQQYLYPQNYLWGDFAAAAVLSALPITIVFLLAQRWLVGGLTAGGVKG