Protein Info for CSW01_18660 in Vibrio cholerae E7946 ATCC 55056

Annotation: glycerate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00045: glycerate kinase
  • amino acids 2 to 374 (373 residues), 524.4 bits, E=8.3e-162
• PF02595: Gly_kinase
  • amino acids 3 to 373 (371 residues), 516.7 bits, E=1.7e-159

Best Hits

Swiss-Prot: 58% identical to GLXK_HAEIN: Glycerate kinase (glxK) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00865, glycerate kinase [EC: 2.7.1.31] (inferred from 100% identity to vco:VC0395_0334)

MetaCyc: 55% identical to glycerate 2-kinase 2 (Escherichia coli K-12 substr. MG1655)
GKI-RXN [EC: 2.7.1.165]

Predicted SEED Role

"Glycerate kinase (EC 2.7.1.31)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Glycine and Serine Utilization or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle (EC 2.7.1.31)

MetaCyc Pathways

• photorespiration II (8/10 steps found)
• photorespiration I (7/9 steps found)
• photorespiration III (7/9 steps found)
• glycolate and glyoxylate degradation I (3/4 steps found)
• superpathway of glycol metabolism and degradation (5/7 steps found)
• 2-O-α-mannosyl-D-glycerate degradation (1/2 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (6/9 steps found)
• D-glucarate degradation I (2/4 steps found)
• D-galactarate degradation I (2/4 steps found)
• formaldehyde assimilation I (serine pathway) (8/13 steps found)
• superpathway of D-glucarate and D-galactarate degradation (2/5 steps found)
• 2-deoxy-D-ribose degradation II (3/8 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (6/31 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycine, serine and threonine metabolism
• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.165 or 2.7.1.31

Protein Sequence (377 amino acids)

>CSW01_18660 glycerate kinase (Vibrio cholerae E7946 ATCC 55056)
MKVVIAPDSFKESLTAKQVCDAIQAGLARVWHDAKFVAIPVADGGEGTVQSLVDATQGRL
VEVKVMGPQGKRVEAFYGILGDNQTAVIEMAAASGLHHVPVAQRDPKLTTSFGTGELIRH
ALDQGVTKLIIGLGGSATNDGGVGMLAALGARFTNADGDPIQLTGGGLRELTHINLQDFD
PRLQHCDILVACDVNNPLCGDKGASAVFGPQKGATPEDVQLLDGALRQFGLLTEKVTGKM
VLESAGAGAAGGMGAALLAYTQARLRPGIEIVLETVQLAYQVSDADLVITGEGRIDSQTV
HGKTPMGVAKVAKRFDVPVLALCGCTGDNYQAVYQCGIDAVFAAVPRAMSLEDALKESDF
NLADLAENVARLWVLSK