Protein Info for CSW01_18625 in Vibrio cholerae E7946 ATCC 55056

Annotation: glucose-6-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00871: glucose-6-phosphate dehydrogenase
  • amino acids 7 to 487 (481 residues), 658.5 bits, E=3.1e-202
• PF00479: G6PD_N
  • amino acids 11 to 192 (182 residues), 221.3 bits, E=1.7e-69
• PF02781: G6PD_C
  • amino acids 194 to 487 (294 residues), 396.5 bits, E=6.4e-123

Best Hits

Swiss-Prot: 68% identical to G6PD_HAEIN: Glucose-6-phosphate 1-dehydrogenase (zwf) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 100% identity to vch:VCA0896)

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (16/17 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• pentose phosphate pathway (8/8 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• pentose phosphate pathway (oxidative branch) I (3/3 steps found)
• heterolactic fermentation (13/18 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• cytosolic NADPH production (yeast) (3/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (5/8 steps found)
• formaldehyde oxidation I (3/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Glutathione metabolism
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.49

Protein Sequence (501 amino acids)

>CSW01_18625 glucose-6-phosphate dehydrogenase (Vibrio cholerae E7946 ATCC 55056)
MMVIPENSSIVIFGASGDLTYRKLIPALYHLYASQQLPKSFAILGVSRTEYSDESYREKL
KRSLQELEKTEPAALEAFMQHVHYQALNTSEVADYQHLATRLDTLANDYQFEQRNTLFYL
ATPPSLYGVIPACLAAHGLNDESQGWKRLIIEKPFGYDLQSAQDLDVEIHHHFKEHQIYR
IDHYLGKETVQNLLVFRFANGMFEPLWNRNFIDYVEITGAEFLGVEERGGYYDGSGAVRD
MFQNHLLQVLAMVGMEPPAAINADSIRNEVNKVLQSLQPLSESDLRNNLVLGQYTESEVR
GQFLPSYRNEPGVAADSRTETYVALKMFINNWRWNGVPFYVRSGKRLPTRVTEVVIHFKR
TPHPVFGQNAPENKLIIRIQPDEGILMSFGLKEPGAGFKAKEVSMNFHYASLEQIKMLTA
YERLLLDALNGDATLFARTDAVEACWKFVQPILDFKQDPQSLYGYACGTWGPKESDDLLR
RDGREWRFPCKNLTNTDYCEL