Protein Info for CSW01_18450 in Vibrio cholerae E7946 ATCC 55056

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 TIGR00229: PAS domain S-box protein" amino acids 27 to 131 (105 residues), 55.8 bits, see alignment E=2.5e-19 amino acids 147 to 256 (110 residues), 55.3 bits, see alignment E=3.7e-19 PF08448: PAS_4" amino acids 31 to 131 (101 residues), 39.1 bits, see alignment E=2.4e-13 amino acids 145 to 250 (106 residues), 37.9 bits, see alignment E=5.7e-13 PF13426: PAS_9" amino acids 33 to 129 (97 residues), 36.7 bits, see alignment E=1.3e-12 amino acids 155 to 249 (95 residues), 41.3 bits, see alignment E=4.7e-14 PF08447: PAS_3" amino acids 39 to 123 (85 residues), 51.2 bits, see alignment E=3.8e-17 amino acids 159 to 243 (85 residues), 55.9 bits, see alignment E=1.3e-18 PF13188: PAS_8" amino acids 138 to 189 (52 residues), 17.4 bits, see alignment 1e-06 PF00015: MCPsignal" amino acids 286 to 424 (139 residues), 121.3 bits, see alignment E=1.2e-38

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to vcm:VCM66_A0823)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>CSW01_18450 hypothetical protein (Vibrio cholerae E7946 ATCC 55056)
MFLFQKQKPSTKPSHQDNIVQSLSEHIASIEFDTSGNVISANPLFLNAVGYRLEELTGKH
HRIFCSPAECQSQQYQQFWTSLAQGKSHSGTFMRYKKDGSLLVLEATYFPIKTDGKVSSV
MKIASDVTEQYLHAESQRDLLTALNQNFAVIEFEPDGTIISANSAFLKTMGYSLDQIKGK
HHRLFCFDEFYQQHPTFWKSLAAGQAYSGRFLRKNSYGSQVWIQASYSPVKDQNNKVYKI
VKFASDITAEVLREQQVTDAANIAYSTSVETSQVAQGGNHVLQDSVRLAEKMVGNIEQSL
QQIEQLVVLSKDVSEIVKTISGIADQTNLLALNAAIEAARAGEQGRGFAVVADEVRQLAS
RTSKATEEINQVVNKNLSLTEAVTSSISQVSQIANETNGRIVEVSTIMEQIYQGAENVSS
AVSQLK