Protein Info for CSW01_18325 in Vibrio cholerae E7946 ATCC 55056

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 32 to 57 (26 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 29 to 293 (265 residues), 92 bits, see alignment E=2.1e-30 PF01545: Cation_efflux" amino acids 32 to 233 (202 residues), 141 bits, see alignment E=2.2e-45

Best Hits

KEGG orthology group: None (inferred from 99% identity to vco:VC0395_0401)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>CSW01_18325 cation transporter (Vibrio cholerae E7946 ATCC 55056)
MRFPHESPECAAKPTRKLTMCSQSNFNEKRVLTLSALIASGFAGSGLLVGLLVGSMVIVF
DGVYSLVSLLLTLLSLAVSRFIQKPSDARFPFGRAVLEPLVIAIKGLVILLIVSYSLYSS
LSALLSGGREVDPSIATLFGVFSVTGCALAWWKMAGLSRRHPSGLIAAEVKQWQMDTLLS
LVVMVGFIAAWLINLTPWAHYSVYADPMMMLLMSFYFIKLPLGMLKSALREILLMAPSHD
IQQAVSHSVQATQEHAEQPLELYGVAKVGRELWVEVALKTAEDDSVEVEDIQRIENHLQQ
SLAALPYQLQLTVSVAR