Protein Info for CSW01_18235 in Vibrio cholerae E7946 ATCC 55056

Annotation: arginine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01273: arginine decarboxylase
  • amino acids 25 to 652 (628 residues), 925.6 bits, E=7.2e-283
• PF02784: Orn_Arg_deC_N
  • amino acids 95 to 364 (270 residues), 158.4 bits, E=3.2e-50
• PF17810: Arg_decarb_HB
  • amino acids 389 to 475 (87 residues), 85.7 bits, E=3.2e-28
• PF17944: Arg_decarbox_C
  • amino acids 603 to 651 (49 residues), 47.3 bits, 3.5e-16

Best Hits

Swiss-Prot: 100% identical to SPEA_VIBCH: Biosynthetic arginine decarboxylase (speA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01585, arginine decarboxylase [EC: 4.1.1.19] (inferred from 100% identity to vcj:VCD_000509)

MetaCyc: 56% identical to biosynthetic arginine decarboxylase (Escherichia coli K-12 substr. MG1655)
Arginine decarboxylase. [EC: 4.1.1.19]

Predicted SEED Role

"Biosynthetic arginine decarboxylase (EC 4.1.1.19)" in subsystem Acid resistance mechanisms or Arginine and Ornithine Degradation or Polyamine Metabolism (EC 4.1.1.19)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (13/17 steps found)
• L-arginine degradation III (arginine decarboxylase/agmatinase pathway) (2/2 steps found)
• putrescine biosynthesis I (2/2 steps found)
• arginine dependent acid resistance (1/1 steps found)
• superpathway of putrescine biosynthesis (3/4 steps found)
• L-arginine degradation IV (arginine decarboxylase/agmatine deiminase pathway) (1/3 steps found)
• putrescine biosynthesis II (1/3 steps found)
• superpathway of polyamine biosynthesis I (4/8 steps found)
• spermidine biosynthesis III (1/4 steps found)
• superpathway of L-arginine and L-ornithine degradation (7/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (5/11 steps found)
• superpathway of polyamine biosynthesis II (2/8 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.19

Protein Sequence (654 amino acids)

>CSW01_18235 arginine decarboxylase (Vibrio cholerae E7946 ATCC 55056)
MISTDEIIVILSVFVRYDVEQPSKLDRVRADYNVHYWSQGFFGIDDQGEVYVSPRKDKAH
QTQLSSIVKQLEARDLNLPVLVRFPQILHQRVHNICDAFNQAIEEYDYPNKYLLVYPIKV
NQQKEVVDEILASQAELEHKQLGLEAGSKPELLAVLAMAQQASSVIVCNGYKDREYIRLA
LIGEKLGHKVFIVLEKLSELDLVLKEAKSLGVKPRLGLRIRLASQGAGKWQSSGGEKSKF
GLAASQVLTVINRLKAENQLEALQLVHFHLGSQMANIRDVRNGVNEAVRFYCELRELGAH
IDFFDVGGGLAVDYDGTRSQSSNSMNYGLHEYARNIVSTVSDVCNLYGQPRPVIISESGR
SITAHHAVLITNVIGTEAYSPEEIPAPGADAPMLLKNMWRGFEEVQHGTDDRALIEIYND
TQSDLSEAHSQFATGVLNLEHRAWAEQLSLRIYHELRQKMSNKNRFHRPILDELQERLAD
KFFVNFSLFQSLPDAWGIDQVFPVLPLSGLEEMNDRRAVMLDITCDSDGAVEQYVEGQGI
ESTLPVPAWTSDKPYLMGFFLVGAYQEILGDMHNLFGDTHSAVVNINDNGESEIAFINEG
DTVEDMMRYVHIDVDKIRTNYRQLVSQRVAKEEQETVLAELELGLSGYTYLEDF