Protein Info for CSW01_18225 in Vibrio cholerae E7946 ATCC 55056

Annotation: aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF04389: Peptidase_M28" amino acids 181 to 379 (199 residues), 152 bits, see alignment E=2.5e-48 PF01546: Peptidase_M20" amino acids 209 to 281 (73 residues), 34 bits, see alignment E=4.4e-12 PF04151: PPC" amino acids 421 to 486 (66 residues), 65.3 bits, see alignment E=1.1e-21

Best Hits

Swiss-Prot: 67% identical to AMPX_VIBPR: Bacterial leucyl aminopeptidase from Vibrio proteolyticus

KEGG orthology group: K05994, bacterial leucyl aminopeptidase [EC: 3.4.11.10] (inferred from 100% identity to vco:VC0395_0421)

Predicted SEED Role

"Bacterial leucyl aminopeptidase precursor (EC 3.4.11.10)" (EC 3.4.11.10)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (501 amino acids)

>CSW01_18225 aminopeptidase (Vibrio cholerae E7946 ATCC 55056)
MNKLFVMALMSAALSANAEDKVWISMGADAVGSLNPALSESLLPHSFASGSQVWIGEVAI
DELAELSHTMHEQHNRCGGYMVHTSAQGAMAALMMPESIANFTIPAPSQQDLVNAWLPQV
SADQITNTIRALSSFNNRFYTTASGAQASDWLANEWRSLISSLPGSRIEQIKHSGYNQKS
VVLTIQGSEKPDEWVIVGGHLDSTLGSHTNEQSIAPGADDDASGIASLSEIIRVLRDNNF
RPKRSVALMAYAAEEVGLRGSQDLANQYKAQGKKVVSVLQLDMTNYRGSAEDIVFITDYT
DSNLTQFLTTLIDEYLPELTYGYDRCGYACSDHASWHKAGFSAAMPFESKFKDYNPKIHT
SQDTLANSDPTGNHAVKFTKLGLAYVIEMANAGSSQVPDDSVLQDGTAKINLSGARGTQK
RFTFELSQSKPLTIQTYGGSGDVDLYVKYGSAPSKSNWDCRPYQNGNRETCSFNNAQPGI
YHVMLDGYTNYNDVALKASTQ