Protein Info for CSW01_18200 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR02136: phosphate binding protein" amino acids 17 to 272 (256 residues), 222.9 bits, see alignment E=2.6e-70 PF12849: PBP_like_2" amino acids 26 to 260 (235 residues), 151.2 bits, see alignment E=7.3e-48 PF13531: SBP_bac_11" amino acids 28 to 271 (244 residues), 57 bits, see alignment E=3.9e-19 PF12727: PBP_like" amino acids 44 to 258 (215 residues), 102.1 bits, see alignment E=3.5e-33

Best Hits

Swiss-Prot: 30% identical to PSTS_BORBU: Phosphate-binding protein PstS (pstS) from Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 100% identity to vco:VC0395_0427)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>CSW01_18200 ABC transporter substrate-binding protein (Vibrio cholerae E7946 ATCC 55056)
MIRMALAAVCALLFSITTMTPFVQASEITISGSTSVARIMDVLAEKYNQQHPETYVAVQG
VGSTAGISLLKKGVADIAMTSRYLTESEAQNTLHTFTLAFDGLAIVVNQANPVTNLTREQ
LYGIYKGQITNWKQVGGNDQKIAVVTREASSGTRYSFESLMGLTKTVKDREVSDVAPTAL
VVNSNSMMKTLVNHNTQAVGFISIGSVDKSVKAIQFEKADPTSDNIAKHTYQLSRPFLIL
HYSDNADEQTKEFIAFLKSESAKKLIVEYGYIMPSDVE