Protein Info for CSW01_18175 in Vibrio cholerae E7946 ATCC 55056

Annotation: LTA synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 657 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 90 to 114 (25 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details PF00884: Sulfatase" amino acids 288 to 558 (271 residues), 170.6 bits, see alignment E=5.3e-54

Best Hits

Swiss-Prot: 53% identical to Y1246_HAEIN: Uncharacterized protein HI_1246 (HI_1246) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to vch:VCA0802)

Predicted SEED Role

"Phosphoglycerol transferase I (EC 2.7.8.20)" (EC 2.7.8.20)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (657 amino acids)

>CSW01_18175 LTA synthase family protein (Vibrio cholerae E7946 ATCC 55056)
MTTLNKLKLFFGPLYPIVCAVFALLVIFALSRLGLAMWHFDRVTNADGWIRIFTSGLRVD
FASICYLFILPALLTSLISGEHWLGRIWNWILRLWITAGLWIVVYMEVATPPFIIEYDLR
PNRLFVEYLIYPKEVFGMLWSGYKLELFIGLVVSVLTVVLGWRWSKTLVSNLHYPKWYWR
PVIAVLVVTVGVLGARSSLGHRPMNPAMVSFSSDPLMNDLALNSAYSVIFAAKQMGSEAN
AFEFYPKMDKQLVIDQVRASMTVAPEDFISDDKPSLANHVATYQGAPKNIVILLMESHGA
RYVKSLGGIDVSPNMDKLINEGWAFTRMYATGTRSVRGIEAVTTGFSPTPARSVVKLGKS
QNNFFSIAGLLKTQQYHTQFIYGGESHFDNMKSFFLGNGFVDMQDLPTFSNPKFVGSWGA
SDEDLFNKADEQFTQMAKEGKPFFSLVFTSSNHSPFEYPDGVITQYNEPKQTVENAVKYA
DYALGQFVEKAKKSPYWDNTVFVVVADHDARTQGTNPIPVEYFHIPAVIFGGGIEARKDD
RLLSQLDLAPTLLSLAGISSQNPMIGFDLTQDVPVEKQRAMMQRDKNFGWLTPDNQVVVL
QPGQDITTYQYDSVTHKMTPLQLDESIVTRAHANAMWGSLAFKENFYTAQKSYELEK