Protein Info for CSW01_18100 in Vibrio cholerae E7946 ATCC 55056

Annotation: sensor domain-containing phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 627 PF01590: GAF" amino acids 19 to 151 (133 residues), 61.5 bits, see alignment E=2.6e-20 PF13185: GAF_2" amino acids 54 to 147 (94 residues), 33.5 bits, see alignment E=9.2e-12 PF00990: GGDEF" amino acids 205 to 355 (151 residues), 62.4 bits, see alignment E=9.1e-21 PF00563: EAL" amino acids 379 to 611 (233 residues), 235.4 bits, see alignment E=1.2e-73

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_A0744)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (627 amino acids)

>CSW01_18100 sensor domain-containing phosphodiesterase (Vibrio cholerae E7946 ATCC 55056)
MAPILSHSIPIPSSMQANWQQMLNLLAEVLKVSATLIMRLRHHDLDVFCTSVGSDNPYQV
GMTERLGTGLYCETVVNTRQILLVSNADLDPLWKDNPDLELGMRAYCGVPLQWPNGELFG
SLCVTDRQARQFLSTDQQLIKTFAESIEAQLKTLYQRETLLQMNQDLHFKVRHKMQSIAS
LNQSLHQEIDKRRAAEQQIEYQRSHDLGTGFLNRTALEQQLAMQLAQLAEHEELAVIHIG
FANARQLQARLGYHLWDDVLKQLRERLGPVTEGELLTARPNSTNLTLILKAHPLDTQLNQ
LCHRLIHAGQAQFVTEGLPVHLNPYIGVALSRETRDPQQLLRHAVSSMLACKDSGYKVFF
HSPALADNHARQNQLENYLLQAVRNNDLLLYFQPKVSMKTQRWVGAEALLRWKHPVLGEF
SNETLIHMAEQNGLIFEVGHFVLHQALKAASDWLAVCPTFCIAINVSSVQLKNSGFVEQI
RDLLALYCFPAHQLELEITESGLIVDEPTASDILNRLHTLGVTLSLDDFGTGYASFQYLK
KFPFDGIKIDKSFMEQIEHSESDQEIVRSMLHVAKKLNLNVVVEGIESTQQEQFILEQGC
DVGQGFLYGKPMPSEVFTLKLESHALA