Protein Info for CSW01_18075 in Vibrio cholerae E7946 ATCC 55056

Annotation: nucleotide sugar dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 1 to 378 (378 residues), 337.4 bits, E=5.6e-105
• PF03721: UDPG_MGDP_dh_N
  • amino acids 1 to 168 (168 residues), 109.4 bits, E=2.5e-35
• PF00984: UDPG_MGDP_dh
  • amino acids 192 to 281 (90 residues), 99.8 bits, E=1.1e-32
• PF03720: UDPG_MGDP_dh_C
  • amino acids 300 to 375 (76 residues), 34.5 bits, E=3.4e-12

Best Hits

Swiss-Prot: 71% identical to UDG_SALTY: UDP-glucose 6-dehydrogenase (udg) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 100% identity to vcj:VCD_000542)

MetaCyc: 70% identical to UDP-glucose 6-dehydrogenase (Escherichia coli K-12 substr. MG1655)
UDP-glucose 6-dehydrogenase. [EC: 1.1.1.22]

Predicted SEED Role

No annotation

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-xylose biosynthesis (1/2 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.22

Protein Sequence (388 amino acids)

>CSW01_18075 nucleotide sugar dehydrogenase (Vibrio cholerae E7946 ATCC 55056)
MKIAIAGTGYVGLSNGILLAQHNEVVALDIVVSRVEQLNDKISPIADPEIESFLQHQPLN
FRATCDKRDAYQDAQFVVIATPTDYDPQTNHFDTRTVEAVIDDVLAINPQAIMVIKSTVP
VGYTKRIKQRLCCNNLIFSPEFLREGRALYDNLYPSRIIVGEKSERGQAFATLLAQGAKK
MDIPILLTHSTEAEAVKLFSNTYLAMRVSFFNELDTYAETHGLDTKQIIEGVGLDPRIGN
HYNNPSFGYGGYCLPKDTRQLLRNFEDVPNNLIRAIVDANTTRKDHIAFSILNRNPKVVG
IYRLIMKSGSDNFRASSILGIMKRIKAQGVEVVIYEPVLNESTFYGSPVIRDLAQFKAMA
EVIVTNRRVAELEDVAEKIYTRDLFGQD