Protein Info for CSW01_18000 in Vibrio cholerae E7946 ATCC 55056

Annotation: NUDIX hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF00293: NUDIX" amino acids 48 to 160 (113 residues), 68 bits, see alignment E=4.2e-23

Best Hits

Swiss-Prot: 38% identical to ADPP_BACSU: ADP-ribose pyrophosphatase (nudF) from Bacillus subtilis (strain 168)

KEGG orthology group: K01515, ADP-ribose pyrophosphatase [EC: 3.6.1.13] (inferred from 99% identity to vcm:VCM66_A0723)

Predicted SEED Role

"ADP-ribose pyrophosphatase (EC 3.6.1.13)" in subsystem NAD and NADP cofactor biosynthesis global or Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.13)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.13

Use Curated BLAST to search for 3.6.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (185 amino acids)

>CSW01_18000 NUDIX hydrolase (Vibrio cholerae E7946 ATCC 55056)
MTPSSPLYFDKTHSMSKIIHQWKSIALVEEDVLLPNGHSVTHTTISHPGAAVILPLTDQG
EIVVIRQFRPSLKKWLLELPAGTIEEGEPPLSCAQRELEEETGFSAQQFIELGQVTPLAG
FCDEIQHLFVAKNLSKTARYSCDEDEVIEVLFLTPQELERKIVFGDITDSKTIACLSKAK
LCGYL