Protein Info for CSW01_17970 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 77 to 81 (5 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 10 to 111 (102 residues), 60.5 bits, see alignment E=9.2e-21 PF00528: BPD_transp_1" amino acids 28 to 216 (189 residues), 74.8 bits, see alignment E=3.9e-25

Best Hits

Swiss-Prot: 49% identical to ARTQ_SHIFL: Arginine ABC transporter permease protein ArtQ (artQ) from Shigella flexneri

KEGG orthology group: K09999, arginine transport system permease protein (inferred from 99% identity to vcm:VCM66_A0717)

MetaCyc: 49% identical to L-arginine ABC transporter membrane subunit ArtQ (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Arginine ABC transporter, permease protein ArtQ" in subsystem Arginine and Ornithine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>CSW01_17970 ABC transporter (Vibrio cholerae E7946 ATCC 55056)
MVLTGYSLSLVQASWMTLQIALASLLVGLLLALVFAGGEMAKLKLIKWPTTLLVTVIRGL
PELLVVLFIYFGSTQVLFFITGEFIEISPFISGVIALSLIFASYASQTLRGALKAVGRGQ
REAASALGIPPSHAFIRIVLPQAVRHALPGLMNQWLVLLKDTALVSLIGVTDLLKQAQLT
SAATHEAFTWYATAAVVYLVITLITQRVVKVIDNKFSIQGMSHSQGASA