Protein Info for CSW01_17925 in Vibrio cholerae E7946 ATCC 55056

Annotation: 3-oxoacyl-ACP synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III
  • amino acids 5 to 324 (320 residues), 357.1 bits, E=4e-111
• PF00108: Thiolase_N
  • amino acids 39 to 145 (107 residues), 29.5 bits, E=1e-10
• PF08545: ACP_syn_III
  • amino acids 107 to 184 (78 residues), 100.4 bits, E=8.3e-33
• PF08541: ACP_syn_III_C
  • amino acids 235 to 324 (90 residues), 119.2 bits, E=1.4e-38

Best Hits

Swiss-Prot: 100% identical to FABH2_VIBCH: 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2 (fabH2) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 99% identity to vcm:VCM66_A0710)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (40/53 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (13/16 steps found)
• superpathway of fatty acid biosynthesis initiation (5/5 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• superpathway of fatty acid biosynthesis II (plant) (30/43 steps found)
• streptorubin B biosynthesis (15/34 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180

Protein Sequence (362 amino acids)

>CSW01_17925 3-oxoacyl-ACP synthase III (Vibrio cholerae E7946 ATCC 55056)
MTQCYAEITGWGKCLPPATLSNHDLSTFLDTSDEWIQSRTGIEQRRISHVNTSDLATVAA
QHAIACAGVSVEEIDLIIVATCSPDSLIPNIASRVQQNLGIPSAAAFDLNAACTGFLYGL
ETATRLMQASHYRHALVIGAERLSFYLDWTKRDTAVLFGDGAGAVVLSKTEQKVGLQDAQ
IGCDAQGRDILAVPKFGTAMDRFDADNGYWAFDFVGKEIFKRAVRGMGAAAQQVLARSGL
STEEIDVVIPHQANIRIIQTLCDLAGIAQDKAFVNIHRYGNTSAATVPIALCEALEQGKI
KPHDDLLVAAFGAGLTWGAGHIRWGERITPLGKSDAQLPSCDHTALDLLSKAIEHCKRHQ
SE