Protein Info for CSW01_17915 in Vibrio cholerae E7946 ATCC 55056

Annotation: anaerobic glycerol-3-phosphate dehydrogenase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07992: Pyr_redox_2
  • amino acids 4 to 39 (36 residues), 29.5 bits, 1.3e-10
• TIGR03378: glycerol-3-phosphate dehydrogenase, anaerobic, B subunit
  • amino acids 4 to 423 (420 residues), 639.2 bits, E=1.6e-196
• PF01134: GIDA
  • amino acids 5 to 43 (39 residues), 26.3 bits, 9.8e-10
• PF01266: DAO
  • amino acids 5 to 45 (41 residues), 29.6 bits, 1.3e-10
• PF00890: FAD_binding_2
  • amino acids 5 to 410 (406 residues), 304.2 bits, E=4.5e-94

Best Hits

Swiss-Prot: 100% identical to GLPB_VIBCH: Anaerobic glycerol-3-phosphate dehydrogenase subunit B (glpB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00112, glycerol-3-phosphate dehydrogenase subunit B [EC: 1.1.5.3] (inferred from 100% identity to vcj:VCD_000571)

Predicted SEED Role

"Anaerobic glycerol-3-phosphate dehydrogenase subunit B (EC 1.1.5.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Respiratory dehydrogenases 1 (EC 1.1.5.3)

MetaCyc Pathways

• glycerol and glycerophosphodiester degradation (4/4 steps found)
• glycerol degradation I (3/3 steps found)
• glycerol-3-phosphate shuttle (2/2 steps found)
• glycerol-3-phosphate to fumarate electron transfer (2/2 steps found)
• glycerophosphodiester degradation (2/2 steps found)
• sn-glycerol 3-phosphate anaerobic respiration (2/3 steps found)
• glycerol 3-phosphate to cytochrome aa₃ oxidase electron transfer (1/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (1/2 steps found)
• glycerol-3-phosphate to hydrogen peroxide electron transport (1/2 steps found)
• nitrate reduction IX (dissimilatory) (1/2 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.5.3

Use Curated BLAST to search for 1.1.5.3

Protein Sequence (436 amino acids)

>CSW01_17915 anaerobic glycerol-3-phosphate dehydrogenase subunit B (Vibrio cholerae E7946 ATCC 55056)
MMHYDVAVIGGGIAGYSAALRALQAGKKVVLINQGQSALHFSSGSIDVLGRLPDGSVVNQ
PFDALSALQQQAPEHPYSKVGRKNSEKGLMWFKRTLDSAHVPLHHEPDGANHWRITPLGT
LKNTWLSQPFVYPYRGNADFSRIMIVAIDGYRDFQPAMLRDNLAQRPELANTPMLTVNVS
IPGFEGFRRNPNELRSIDIARLLRQESAWNALCDQLMRVARPDDLVIMPAIMGNGDGLHL
MSKLQQVTQLRFHEVPTMPPSLLGIRIEEALHRSFIQGGGVQLKGDKVIGGNFAGSRLTA
IHTQNLRDFPISAEHYVMATGSYFSQGLQASQHAIQEPIFALDVQQNPDRAQWRHAQFIA
AQSHPFMTFGVTTDANLHPSRQGKTIDNLWCCGAMLSGYDPVFEGCGGGVAIATAYHAVE
QILATYAQTKQPEVLL