Protein Info for CSW01_17870 in Vibrio cholerae E7946 ATCC 55056

Annotation: GIY-YIG nuclease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 PF01541: GIY-YIG" amino acids 11 to 83 (73 residues), 61.2 bits, see alignment E=4.9e-21

Best Hits

Swiss-Prot: 100% identical to Y3539_VIBCH: UPF0213 protein VC_A0739 (VC_A0739) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07461, putative endonuclease (inferred from 99% identity to vco:VC0395_0675)

MetaCyc: 62% identical to DNA damage response nuclease YhbQ (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease I. [EC: 3.1.11.1]

Predicted SEED Role

"COG2827: putative endonuclease containing a URI domain"

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.1

Use Curated BLAST to search for 3.1.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (101 amino acids)

>CSW01_17870 GIY-YIG nuclease family protein (Vibrio cholerae E7946 ATCC 55056)
MENLAELPSPWFVYLVRCANNALYCGITTDVSRRFAQHQKGRGAKALRGKGPLELVWSLP
VADGKSAALKLEYRIKALSKSQKEALVAGMARIDQLEIIFQ