Protein Info for CSW01_17745 in Vibrio cholerae E7946 ATCC 55056

Annotation: diacylglycerol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01219: DAGK_prokar
  • amino acids 16 to 117 (102 residues), 121.6 bits, E=5.6e-40

Best Hits

Swiss-Prot: 56% identical to KDGL_SHIFL: Diacylglycerol kinase (dgkA) from Shigella flexneri

KEGG orthology group: K00901, diacylglycerol kinase [EC: 2.7.1.107] (inferred from 100% identity to vch:VCA0714)

MetaCyc: 56% identical to diacylglycerol kinase (Escherichia coli K-12 substr. MG1655)
Diacylglycerol kinase. [EC: 2.7.1.107]

Predicted SEED Role

"Diacylglycerol kinase (EC 2.7.1.107)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.1.107)

MetaCyc Pathways

• diacylglycerol and triacylglycerol biosynthesis (3/7 steps found)
• phosphatidate metabolism, as a signaling molecule (1/5 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycerophospholipid metabolism
• Phosphatidylinositol signaling system

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.107

Protein Sequence (118 amino acids)

>CSW01_17745 diacylglycerol kinase (Vibrio cholerae E7946 ATCC 55056)
MKHSRTGFSRIIYATGYSMKGFAAAWKNEAAFRQEVTLALPLIALSFFLPVSTIEQVLMV
GSLVLILIAELLNSAIEAVVDRIGAERHELSGRAKDIGSAAVFVSLCFAAFTWTWILL