Protein Info for CSW01_17635 in Vibrio cholerae E7946 ATCC 55056

Annotation: class I poly(R)-hydroxyalkanoic acid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 591 transmembrane" amino acids 316 to 335 (20 residues), see Phobius details TIGR01838: poly(R)-hydroxyalkanoic acid synthase, class I" amino acids 55 to 584 (530 residues), 870.2 bits, see alignment E=2.4e-266 PF07167: PhaC_N" amino acids 95 to 266 (172 residues), 236.3 bits, see alignment E=1.7e-74 PF00561: Abhydrolase_1" amino acids 262 to 510 (249 residues), 63.4 bits, see alignment E=2.8e-21

Best Hits

Swiss-Prot: 43% identical to PHAC_AZOC5: Poly(3-hydroxyalkanoate) polymerase subunit PhaC (phaC) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K03821, polyhydroxyalkanoate synthase [EC: 2.3.1.-] (inferred from 100% identity to vcm:VCM66_A0646)

Predicted SEED Role

"Polyhydroxyalkanoic acid synthase" in subsystem Polyhydroxybutyrate metabolism

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (591 amino acids)

>CSW01_17635 class I poly(R)-hydroxyalkanoic acid synthase (Vibrio cholerae E7946 ATCC 55056)
MFQHAFTDYLVQLQQVNQRWWKEVEQSKAAVNSPLNKAMQEVNLEDSLKFFEQAANQPAA
LLKVQTQWWEQQLQIWQKVVLESKIQSIMEAEKGDKRFSHEAWQQDPFFNFIKQSYLLFS
KTYLDTINAIEGLDEKAKERILFFSRQMINALSPSNFIATNPELLRLTLEKNGENLIAGL
EQLKEDVASSADILKIRMTNNNAFRLGEDVANTPGEVVFKNEVFELIQYKPLTEQVAVTP
LLIVPPFINKYYILDLREKNSMVRWLVEQGHSVFMISWRNPGAAQAQLNFEDYVLEGVVK
AVNAIESITGQEQINAAGYCIGGTVLATTIAYYAAKRMKKRIKTASFFTTLLDFSQPGEV
GAYINDTIIRAIELQNNAKGYMDGRSLSVTFSLLRENSLYWNYYVDNYLKGQSPVDFDLL
YWNSDSTNVAGACHNFLLRELYLENKLVQDKGVKVGGVWIDLDKIKVPSYFISTKEDHIA
LWQGTYRGALRTGGNKTFVLGESGHIAGIVNHPDKRKYGYWVNDTLDDSAEDWLETAQHR
EGSWWVHWNEWLNGFADGSKVEPYPLGNADYPVLYSAPGEYVKQVLPIQEA