Protein Info for CSW01_17600 in Vibrio cholerae E7946 ATCC 55056

Annotation: HDIG domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 PF01966: HD" amino acids 42 to 153 (112 residues), 23.9 bits, see alignment E=6.5e-09 amino acids 253 to 374 (122 residues), 70.9 bits, see alignment E=1.7e-23 PF08668: HDOD" amino acids 230 to 295 (66 residues), 27.6 bits, see alignment E=2.8e-10 PF13487: HD_5" amino acids 241 to 407 (167 residues), 129.3 bits, see alignment E=2e-41 TIGR00277: HDIG domain" amino acids 251 to 298 (48 residues), 29.9 bits, see alignment 2.1e-11

Best Hits

Swiss-Prot: 100% identical to CGAP1_VIBCH: 3'3'-cGAMP-specific phosphodiesterase 1 (VC_A0681) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_A0639)

Predicted SEED Role

"Putative metal-dependent phosphohydrolase with tandem HD motifs"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>CSW01_17600 HDIG domain-containing protein (Vibrio cholerae E7946 ATCC 55056)
MRWSEIGCTMKSVNIEWNVNLRQAFFCIARALDSVGVDDINHGHRVGYMAYSCAQAMEWS
EEECQLVFALGLIHDCGVAQKRDFYRLLENMQPDNTQQHCVRGNELLSNCPPLAPFADAI
LYHHTPWDELKNIAISDRNKRFAALIFLADRVDYLKELYPRDEYGNVTQEARNQVCLEIG
RLSGSLFERDLVRTMQHLLSKEFIWFSMEHHHIEAMGHNLPSTPFFEQKLGVEEIMSIAM
LMANVVDAKSQFTFQHSQKVAELCQHLAKELGLNVEMQKALYLTGLVHDIGKLHTPEEIL
HKPGKLNESEYLCIQRHSTDSRYTLQMVFGQSVVCEWAGNHHERLDGSGYPRGLQGAAID
LPSRIIAIADVFQALTQARPYRGSMSLNEVMNIMRHEVSCGRLDSQVFDVIVRNSQQYYQ
LSIAESPTEWA