Protein Info for CSW01_17585 in Vibrio cholerae E7946 ATCC 55056

Annotation: periplasmic nitrate reductase electron transfer subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03892: NapB
  • amino acids 32 to 145 (114 residues), 169.1 bits, E=2.4e-54

Best Hits

KEGG orthology group: K02568, cytochrome c-type protein NapB (inferred from 99% identity to vco:VC0395_0618)

MetaCyc: 86% identical to nitrate reductase small subunit (Aliivibrio fischeri)
Nitrate reductase (cytochrome). [EC: 1.9.6.1]

Predicted SEED Role

"Nitrate reductase cytochrome c550-type subunit" in subsystem Nitrate and nitrite ammonification

MetaCyc Pathways

• sn-glycerol 3-phosphate anaerobic respiration (2/3 steps found)
• nitrate reduction IV (dissimilatory) (1/2 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.9.6.1

Protein Sequence (151 amino acids)

>CSW01_17585 periplasmic nitrate reductase electron transfer subunit (Vibrio cholerae E7946 ATCC 55056)
MKKQLIALLSVFTVLAGIAHAELNNPGGIGGLESLRGATEIEATRAADPMKKYPREQALE
SDFVYQPPLIPHNIRNYEVSLNANKCLACHSWKNAKEMGATKISVTHFVNREDAVLSDVS
PRRYFCLQCHVPQADAKPLVENDFERVDSLR