Protein Info for CSW01_17565 in Vibrio cholerae E7946 ATCC 55056

Annotation: nitrate/nitrite two-component system sensor histidine kinase NarQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 158 to 183 (26 residues), see Phobius details PF13675: PilJ" amino acids 43 to 137 (95 residues), 84.9 bits, see alignment E=1.1e-27 PF00672: HAMP" amino acids 186 to 232 (47 residues), 36.5 bits, see alignment 1.3e-12 PF07730: HisKA_3" amino acids 374 to 442 (69 residues), 57.2 bits, see alignment E=5.1e-19 PF02518: HATPase_c" amino acids 485 to 572 (88 residues), 55.3 bits, see alignment E=2.1e-18

Best Hits

KEGG orthology group: K07674, two-component system, NarL family, nitrate/nitrite sensor histidine kinase NarQ [EC: 2.7.13.3] (inferred from 100% identity to vco:VC0395_0614)

Predicted SEED Role

"Nitrate/nitrite sensor protein (EC 2.7.3.-)" in subsystem Nitrate and nitrite ammonification (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (583 amino acids)

>CSW01_17565 nitrate/nitrite two-component system sensor histidine kinase NarQ (Vibrio cholerae E7946 ATCC 55056)
MVINQRETALFTPVRHSLTRTMAKAMLLILFLSALTTGVAIVTLASSLNDAEAVNVSGSM
RMQSYRLAYDIQTQSHDYKAHIFLFENSLYSPSMLALLDWTVPSDIQQDYYQLIERWHEL
KKVLNSDQKAQYLDQVAPFVSLVDGFVLKLQRFSERKLIALAAVGSFGLGGIFAVSLFVV
YYIREQVVRPLNAMVDASEKIKNRNFDVMLEETSSTEMGILSRTFNSMAGDLGKLYRGLE
HAVNEKTNKLQMANQSLQVLYHSSQELTASRITASNFQTILRHWVALEGICALRLEIEEE
AGKPLILQEGKPSGAVMLQTPLTLDGHHLGFLYWEAGSPEPDRALIDNFALILSRAIYYN
QAQRQAEQLLLMEERATIARELHDSLAQSLSYLKIQLTLLKRSVTPLKSDGDLSKTENII
REIDKGLSDAYTQLRELLTTFRLTLTEGSFGQSLLGMLTQLSGQTDAKIELNNALSSIAL
DAHQQVHLVQLIREATINAIKHAKATKIKVNCQEQQGRVQVTIEDDGVGFDLQDHKINHY
GMSIMQERAARLRGELKVESAPGKGCKVVLTYQQSEEKNKNEL