Protein Info for CSW01_17545 in Vibrio cholerae E7946 ATCC 55056

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 110 to 135 (26 residues), see Phobius details amino acids 144 to 168 (25 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details amino acids 300 to 318 (19 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details amino acids 362 to 384 (23 residues), see Phobius details amino acids 393 to 413 (21 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 368 (346 residues), 103.5 bits, see alignment E=1.8e-33 amino acids 244 to 419 (176 residues), 38.3 bits, see alignment E=1.2e-13 PF00083: Sugar_tr" amino acids 24 to 367 (344 residues), 47.8 bits, see alignment E=1.5e-16 PF12832: MFS_1_like" amino acids 252 to 332 (81 residues), 25.7 bits, see alignment E=9.5e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_000655)

Predicted SEED Role

"4-hydroxybenzoate transporter" in subsystem Cinnamic Acid Degradation or Gentisare degradation or Phenylpropanoid compound degradation or Salicylate and gentisate catabolism or p-Hydroxybenzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>CSW01_17545 MFS transporter (Vibrio cholerae E7946 ATCC 55056)
MTTKKHMSEVPMIQRVAAYLAILVGYFFYCYNFVIIDYVRPYIVEAYEGISLSDTAQFYT
WQSVGALIGALSCAWFAGRFGKKYTLITITALNGGATIVNMMFTDYATWAAMRFIIGLSL
GGYFTVAVSLMIGLFTPTVRGKLTAFASSMFSVALMVMGAYAAFISSIDAPWESLMWVGG
IPPLAAAFAMVFVLPSDKNVIAYGEEDSSANTGQNTPAKKGSWGEMLSKPYRLLTITCLL
LAGLNFYGFQFFSGFVTTYLKEVRQFDGATIGVIFSISAFGSLFGAWVWGAVADKFGRKV
NAFGFILAGIMASIFFIAPSDLMIGSLNMLAILGLIYNFGLSSSAVWGGYFSELFPAHLR
SYGAALFHGGRIIGMWAPMVLIFIKERTDLQTAMWGSPIVWIVAGLLWLSLPETLKGGLF
DKRKSNQPANA