Protein Info for CSW01_17475 in Vibrio cholerae E7946 ATCC 55056

Annotation: PTS maltose transporter subunit IIBC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 transmembrane" amino acids 112 to 135 (24 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 229 to 246 (18 residues), see Phobius details amino acids 262 to 284 (23 residues), see Phobius details amino acids 302 to 322 (21 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 376 to 395 (20 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details amino acids 444 to 466 (23 residues), see Phobius details TIGR01996: PTS system, sucrose-specific IIBC component" amino acids 3 to 464 (462 residues), 644 bits, see alignment E=1.8e-197 PF00367: PTS_EIIB" amino acids 8 to 41 (34 residues), 51.7 bits, see alignment (E = 4.7e-18) TIGR00826: PTS system, glucose-like IIB component" amino acids 28 to 110 (83 residues), 77.5 bits, see alignment E=1.2e-25 PF02378: PTS_EIIC" amino acids 110 to 410 (301 residues), 191.3 bits, see alignment E=2.3e-60 TIGR00852: PTS system, maltose and glucose-specific subfamily, IIC component" amino acids 164 to 453 (290 residues), 309.5 bits, see alignment E=3.4e-96

Best Hits

Swiss-Prot: 81% identical to PTSBC_VIBAL: PTS system sucrose-specific EIIBC component (scrA) from Vibrio alginolyticus

KEGG orthology group: K02809, PTS system, sucrose-specific IIB component [EC: 2.7.1.69] K02810, PTS system, sucrose-specific IIC component (inferred from 100% identity to vch:VCA0653)

MetaCyc: 59% identical to Enzyme IIscr (Staphylococcus xylosus)
SUCROSEPHOSPHO-RXN [EC: 2.7.1.211]

Predicted SEED Role

"PTS system, sucrose-specific IIB component (EC 2.7.1.69) / PTS system, sucrose-specific IIC component (EC 2.7.1.69)" in subsystem Sucrose utilization (EC 2.7.1.69)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.211 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (479 amino acids)

>CSW01_17475 PTS maltose transporter subunit IIBC (Vibrio cholerae E7946 ATCC 55056)
MDYPVIAKQLLESLGGKSNIQALAHCATRLRLVLNDETQINESAIESLQGVKGQFKVAGQ
YQIIFGSGIVNQVYAEMAKLTGLVEMSTNDVASAGAEKQNWAQRAVKGLSDIFVPIIPAI
VAGGLLMGLFNVLTAPGLFIEGQSLIDANPGLADLASMINTFANAPFVYLPVLLAFSASR
KFGGNPFLGAALGMLMVHPDLLNGWGFGSASVSGTVPTWNILGFEIEKVGYQGSVLPVLV
SAYILAKIENGLRKIVPSVVDNLLTPMLAIFITGFLTFTVVGPLTRDVGFMLGDALNWLY
DSAGFVGGALFGFIYAPFVITGMHHSFIAIETQLLADIVTTGGTFIFPIAAMSNIAQGAA
ALAVGVMTKETKLKGVAIPSGVTALLGITEPAMFGVNLKLRYPFIAAICGAALASAFITL
FNVKAQALGAAGLPGIISINPQQIGYYIMGMAISFVAAFALTVLLAMREKTKQAAQVTA