Protein Info for CSW01_17405 in Vibrio cholerae E7946 ATCC 55056

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 27 to 328 (302 residues), 211.2 bits, see alignment E=9.2e-67 PF16576: HlyD_D23" amino acids 50 to 261 (212 residues), 77.2 bits, see alignment E=2.3e-25 PF13533: Biotin_lipoyl_2" amino acids 51 to 97 (47 residues), 37 bits, see alignment 4.6e-13 PF13437: HlyD_3" amino acids 160 to 258 (99 residues), 35.4 bits, see alignment E=3.1e-12

Best Hits

KEGG orthology group: None (inferred from 99% identity to vco:VC0395_0583)

Predicted SEED Role

"Membrane-fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>CSW01_17405 efflux RND transporter periplasmic adaptor subunit (Vibrio cholerae E7946 ATCC 55056)
MKALSWSIALVLASSAYAQNQDSNERFTVKTELISQIVELDGVVQPVNQGSLAAQTSGRV
VGLYVDVNDFVKKDQVLLEISAVQQSAALDAAQAQLASATAQNREAQAQLNRYRQLFPKG
AISKDQMDSAEARARSADAAVKSAQAAVEQAKESLGYTNITAPYDGIVTQRMVELGETVA
PGTPLLRGFSLDELRVETEIPQRYQPYVADVSQFTVRTAQGEQLKPVEFSLFSYADPQSH
TFKTRLELPQNSAALVPGMWVKTEFNYGQREVLVVPSSAVLRRAELSAVYRVNNGQRALN
PVRLGQVYGDYVEVLSGLELGDVVATQAVTAKGE